SKU: 2671476529

Human CD40, His Tag

Sale price$135.00 Regular price$150.00
Save 10%

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 9 - Jul 14

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human CD40, His TagProduct Specification Species Human Synonyms Tumor necrosis factor receptor superfamily member 5, B cell surface antigen CD40, Bp50, CDw40, CD40L receptor Accession P25942 Amino Acid Sequence Protein sequence (P25942, Glu21 Arg193, with C 10*His) EPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLRGGGGSHHHHHHHHHH Expression System

Product Specification


Species Human
Synonyms Tumor necrosis factor receptor superfamily member 5, B-cell surface antigen CD40, Bp50, CDw40, CD40L receptor
Accession P25942
Amino Acid Sequence

Protein sequence (P25942, Glu21-Arg193, with C-10*His) EPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLRGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Predicted MW: 21.1 kDa Observed MW: 30 kDa
Purity >95% by SDS-PAGE
Conjugation Unconjugated
Tag with C-His tag
Physical Appearance Lyophilized Powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

CD40 is a receptor on antigen-presenting cells of the immune system and is essential for mediating a broad variety of immune and inflammatory responses including T cell-dependent immunoglobulin class switching, memory B cell development, and germinal center formation. AT-hook transcription factor AKNA is reported to coordinately regulate the expression of CD40 and its ligand, which may be important for homotypic cell interactions. Adaptor protein TNFR2 interacts with CD40 and serves as a mediator of the signal transduction. The interaction of CD40 and its ligand is found to be necessary for amyloid-beta-induced microglial activation, and thus is thought to be an early event in Alzheimer disease pathogenesis. Moreover, CD40 molecule is a potential target for cancer immunotherapy.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 2671476529

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.7 ★★★★★
Based on 510 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
S
Verified Purchase
Sue
Bozeman, US
★★★★★ 1
Total waste of money
Color: Classic, Size: L 3.94 in (10 cm)
I seldom write reviews, but save your money as far as I’m concerned. Maybe mine was faulty. I don’t know. But it’s hard as a rock and too big for to my Australian Shepherd to get her teeth around. It barely made a noise. Maybe I misunderstood the description, but I bought it for her because she’s blind and yet loves to play fetch so I thought it was going to make enough noise for her to find it, but it was a total bust at least for me.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 10, 2026
D
Verified Purchase
Dean Law
Los Angeles, US
★★★★★ 4
Nice for play
Color: Classic, Size: XL 5.51 in (14 cm)
Work as expected but only lasted for about an hour
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 28, 2026
T
Verified Purchase
Toy Lady
Alexandria, US
★★★★★ 5
It is sturdy plastic
Color: Classic, Size: XL 5.51 in (14 cm)
The dogs love it
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 28, 2026
M
Verified Purchase
Mustang Sally
Whiting, US
★★★★★ 3
Very Disappointing
Color: Classic, Size: S 3.14 in (8 cm)
The ball is a hard plastic; not flexible at all and uncomfortable for my dog to pick up. It makes NO NOISE while rolling across the floor. I bought it for my newly blind dog because other dog owners said their blind dogs can track the squeaky noise and follow the ball. How... when it doesn't make the noise it's supposed to? It works only if I shake it, totally defeating the purpose. It would be difficult for my dog to chew on the hard plastic, so durability seems pretty good. It's also a nice looking toy, and I think it's safe, as there are no loose parts and the squeaker would be difficult to get to for most dogs. My dog WANTS to enjoy it, but she can't.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 14, 2026
L
Verified Purchase
Laurie
Whiting, US
★★★★★ 5
Dog loves it
Color: Classic, Size: XS 2.75 in (7 cm)
My min pin loves this ball. Only negative is it’s a little too big for her but she manages to still pick it up
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 12, 2026

recommand products